The short version of Stability testing fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2026-02-11. Anything still debated is marked as such rather than presented as settled.
Manufacturing processes can leave trace amounts of dicyandiamide, creatinine, or residual solvents, depending on the synthetic route and purification steps. Heavy metals, arsenic, and microbial contamination are also monitored for food or pharmaceutical grades. Particle size distribution can affect dissolution behavior and blending uniformity, so it may be specified for certain applications. Analytical results are reported on a dry basis or as-is basis, and the difference matters when comparing certificates of analysis. Open questions remain about how minor impurities influence long-term stability under varied storage conditions.
Stability studies typically examine the effects of temperature, humidity, and light on creatine monohydrate. Sealed containers stored in cool, dry conditions help limit moisture uptake and hydrolysis. Elevated temperature and high relative humidity can accelerate conversion to creatinine, especially in aqueous solutions. In solid dosage forms, excipients and processing steps may also affect stability. Published stability data are not fully consistent across studies because test conditions and analytical methods vary.
Quality control of creatine monohydrate relies on a combination of identity, purity, and moisture tests. High-performance liquid chromatography with ultraviolet detection is widely used to separate creatine from creatinine and other related nitrogenous compounds. Spectroscopic methods such as infrared and nuclear magnetic resonance provide structural confirmation. Because the material is a hydrate, water content is measured separately, often by Karl Fischer titration. These tests together establish whether a lot meets a defined specification.
Creatine monohydrate is a crystalline compound formed when one molecule of creatine binds with one molecule of water. Creatine itself is a nitrogen-containing organic acid involved in cellular energy transfer, particularly in muscle and nerve tissue. The monohydrate form is the most common solid form used in research and commercial products because it is relatively stable and easy to handle. Its molecular formula is C4H9N3O2·H2O, and its molar mass is about 149.15 grams per mole.
In the human body, creatine is synthesized mainly in the liver and kidneys from the amino acids glycine, arginine, and methionine. Dietary sources include meat, fish, and other animal tissues, which supply preformed creatine. Because plant foods contain little or no creatine, dietary intake varies widely among populations. The compound is stored largely in skeletal muscle, where it is converted to phosphocreatine and used to regenerate adenosine triphosphate during short bursts of activity.
| Property | Value | Notes |
|---|---|---|
| Assay method | HPLC with UV detection | Commonly used for content and purity |
| Water content | Karl Fischer titration | Measures total water including hydration |
| Identity test | FTIR or NMR spectroscopy | Confirms chemical structure |
| Common impurities | Dicyandiamide, creatinine | Process-related or degradation markers |
| Storage condition | Dry, sealed, 15–25 °C | Protect from moisture and heat |
The compound was identified in the nineteenth century after chemists isolated a nitrogenous substance from meat extracts. Later work established its role in muscle energy metabolism and its conversion to phosphocreatine. Chemical synthesis of creatine followed, and industrial production made the monohydrate widely available as a purified powder. Interest expanded in the late twentieth century when researchers began studying creatine supplementation and muscle physiology. Historical accounts sometimes differ on exact dates and attributions, but the broad sequence from tissue extracts to synthetic production is well documented.
In the body, creatine is obtained from dietary meat and fish and is also synthesized from arginine, glycine, and methionine. Muscle stores creatine and phosphocreatine, which participate in the rapid regeneration of adenosine triphosphate during short, intense activity. The monohydrate form is used in research because it is chemically defined, stable as a dry solid, and relatively inexpensive to produce. Questions remain about whether other creatine forms offer meaningful advantages in absorption or tissue retention, and findings vary across studies and populations.
Creatine monohydrate is a crystalline compound formed from creatine and one molecule of water. Creatine itself is a nitrogen-containing organic acid that occurs in vertebrate muscle and other tissues. The monohydrate designation refers to the water included in the crystal lattice, not to water added during manufacturing. Its chemical formula is commonly written as C4H9N3O2·H2O. The solid is typically a white, odorless powder with low solubility in water at room temperature. It is one of several creatine forms described in scientific and commercial literature.
Creatine monohydrate is a crystalline organic compound formed from creatine and water in a one-to-one ratio. It belongs to the guanidino family and contains a methylated guanidine group attached to an acetate-like chain. The solid is commonly described as a white, odorless powder with a mildly bitter taste. Its molecular formula is C4H11N3O3·H2O, and the hydrated form is the most widely traded grade. The compound occurs naturally in vertebrate muscle and brain tissue, where it participates in rapid energy buffering.
In aqueous solution, creatine monohydrate exists mainly as a zwitterion, carrying both a positive guanidinium charge and a negative carboxylate charge. This charge separation raises water solubility relative to many neutral organic solids and helps explain its behavior in analytical separations. The monohydrate can lose its water of crystallization under sustained heat or low humidity, converting toward anhydrous creatine. Such transitions matter for mass balance calculations because the hydrate contributes water mass that is not part of the active creatine molecule.
The term creatine monohydrate is often shortened to creatine in casual usage, though other creatine forms exist, including citrate, nitrate, and hydrochloride salts. These alternative forms differ in solubility, pH behavior, and the amount of creatine delivered per unit mass. Regulatory categories vary by country: some jurisdictions treat it as a food ingredient, while others place it under supplement or drug frameworks depending on claims and presentation. Standard reference texts list it as a naturally occurring nitrogenous organic acid rather than a vitamin or mineral.
Quality control for creatine monohydrate typically combines identity, assay, and impurity tests. High-performance liquid chromatography with ultraviolet detection is common for separating creatine from creatinine and related substances. Nuclear magnetic resonance and infrared spectroscopy can confirm molecular structure, while titration may assess acid-base content. Moisture content, heavy metals, residual solvents, and microbial limits are checked according to applicable standards. These tests help distinguish compliant material from powders that have degraded, been diluted, or contain manufacturing residues.
Handling practices aim to limit moisture uptake and thermal exposure. Containers should stay closed when not in use, and storage areas should avoid direct sunlight, strong heat, and high humidity. Caking can occur when powder absorbs water, even if the creatine itself has not fully degraded. Aqueous stock solutions are best prepared fresh when needed because they are less stable than the solid. Open questions include how different excipients, packaging materials, and climate conditions affect long-term stability across global supply chains.
Solid creatine monohydrate is relatively stable when kept dry and sealed, but heat and moisture accelerate its conversion to creatinine. This degradation involves intramolecular cyclization, a process that removes water and forms a less useful compound for phosphocreatine metabolism. Powder stored under cool, dry conditions can remain within specification for extended periods, though exact shelf life depends on packaging, humidity, and initial purity. Aqueous solutions degrade faster than dry powder, with pH and temperature influencing the rate. Because degradation is gradual, analytical testing is used to confirm potency at manufacture and during stability studies.
Creatine monohydrate is a crystalline compound formed from creatine and one molecule of water. Its systematic name is N-(aminoiminomethyl)-N-methylglycine monohydrate, and it appears as a white, odorless powder with limited solubility in water. The monohydrate is the most common solid form used in research and commercial products because it is stable under dry conditions. The anhydrous form lacks the water of crystallization and differs slightly in molar mass. Both forms participate in the same biochemical reactions once dissolved.
In the body, creatine is synthesized from the amino acids arginine, glycine, and methionine, primarily in the liver and kidneys. It is transported to muscle and other tissues, where it is phosphorylated to phosphocreatine by creatine kinase. This phosphagen system provides a rapid source of adenosine triphosphate during short, intense contractions. Dietary creatine comes mainly from meat and fish, and the body's total pool is influenced by both synthesis and intake.
As a supplement, creatine monohydrate is studied for its effects on muscle performance and recovery. The compound is often described as an ergogenic aid, meaning it may support physical work capacity. Research typically compares it with placebo or other forms, such as citrate or nitrate, under controlled conditions. Questions remain about the optimal dose and long-term effects in different populations, and findings are not uniform across all studies. The monohydrate form remains the most extensively tested.
5-Oxo-ETE and 5-oxo-15(S)-hydroxy-ETE but not 5-hydroxy members of the 5-HETE family such as 5-(S)-HETE activate peroxisome proliferator-activated receptor gamma (PPARγ). This activation does not proceed through OXER1; rather, it involves the direct binding of the oxo analog to PPARγ with 5-oxo-15-(S)-hydroxy-ETE being more potent than 5-oxo-ETE in binding and activating PPARγ. The Activation of OXER1 receptor and PPARγ by the oxo analogs can have opposing effects on cell function. For example, 5-oxo-ETE-bound OXER1 stimulates whereas 5-oxo-ETE-bound PPARγ inhibits the proliferation of various types of human cancer cell lines; this results in 5-oxo-ETE and 5-oxo-15-(S)-HETE having considerably less potency than anticipated in stimulating these cancer cells to proliferate relative to the potency of 5-(S)-HETE, a relationship not closely following the potencies of these three compounds in activating OXER1. 5-Oxo-ETE relaxes pre-contracted human bronchi by a mechanism that does not appear to involve OXER1 but is otherwise undefined.
The Association of Public Health Laboratories (APHL) is a membership organization in the United States representing the laboratories that protect the health and safety of the public. APHL serves as a liaison between public health laboratories and federal and international agencies. Membership consists of local, state, county, and territorial public health laboratories; public health environmental, agricultural and veterinary laboratories; and corporations and individuals with an interest in public health and laboratory science. APHL is a non-profit, 501(c)(3) organization with a history of over fifty years.
Aminoacyl-tRNA synthetase enzymes consume ATP in the attachment tRNA to amino acids, forming aminoacyl-tRNA complexes. Aminoacyl transferase binds AMP-amino acid to tRNA. The coupling reaction proceeds in two steps: aa + ATP ⟶ aa-AMP + PPi aa-AMP + tRNA ⟶ aa-tRNA + AMP The amino acid is coupled to the penultimate nucleotide at the 3′-end of the tRNA (the A in the sequence CCA) via an ester bond (roll over in illustration). Transporting chemicals out of a cell against a gradient is often associated with ATP hydrolysis. Transport is mediated by ATP binding cassette transporters. The human genome encodes 48 ABC transporters, that are used for exporting drugs, lipids, and other compounds.
Sources: en.wikipedia.org
Helices observed in proteins can range from four to over forty residues long, but a typical helix contains about ten amino acids (about three turns). In general, short polypeptides do not exhibit much α-helical structure in solution, since the entropic cost associated with the folding of the polypeptide chain is not compensated for by a sufficient amount of stabilizing interactions. In general, the backbone hydrogen bonds of α-helices are considered slightly weaker than those found in β-sheets, and are readily attacked by the ambient water molecules. However, in more hydrophobic environments such as the plasma membrane, or in the presence of co-solvents such as trifluoroethanol (TFE), or isolated from solvent in the gas phase, oligopeptides readily adopt stable α-helical structure. Furthermore, crosslinks can be incorporated into peptides to conformationally stabilize helical folds. Crosslinks stabilize the helical state by entropically destabilizing the unfolded state and by removing enthalpically stabilized "decoy" folds that compete with the fully helical state. It has been shown that α-helices are more stable, robust to mutations and designable than β-strands in natural proteins, and also in artificially designed proteins.
The tumor-suppressor protein p53 accumulates when DNA is damaged due to a chain of biochemical factors. Part of this pathway includes alpha-interferon and beta-interferon, which induce transcription of the p53 gene, resulting in the increase of p53 protein level and enhancement of cancer cell-apoptosis. p53 prevents the cell from replicating by stopping the cell cycle at G1, or interphase, to give the cell time to repair; however, it will induce apoptosis if damage is extensive and repair efforts fail. Any disruption to the regulation of the p53 or interferon genes will result in impaired apoptosis and the possible formation of tumors.
P-glycoprotein (3.A.1.201.1) is a well-studied protein associated with multi-drug resistance. It belongs to the human ABCB (MDR/TAP) family and is also known as ABCB1 or MDR1 Pgp. MDR1 consists of a functional monomer with two transmembrane domains (TMD) and two nucleotide-binding domains (NBD). This protein can transport mainly cationic or electrically neutral substrates as well as a broad spectrum of amphiphilic substrates. The structure of the full-size ABCB1 monomer was obtained in the presence and absence of nucleotide using electron cryo crystallography. Without the nucleotide, the TMDs are approximately parallel and form a barrel surrounding a central pore, with the opening facing towards the extracellular side of the membrane and closed at the intracellular face. In the presence of the nonhydrolyzable ATP analog, AMP-PNP, the TMDs have a substantial reorganization with three clearly segregated domains. A central pore, which is enclosed between the TMDs, is slightly open towards the intracellular face with a gap between two domains allowing access of substrate from the lipid phase. Substantial repacking and possible rotation of the TM helices upon nucleotide binding suggests a helix rotation model for the transport mechanism.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
The first definition of the term bioinformatics was coined by Paulien Hogeweg and Ben Hesper in 1970, to refer to the study of information processes in biotic systems. This definition placed bioinformatics as a field parallel to biochemistry (the study of chemical processes in biological systems). Bioinformatics and computational biology involved the analysis of biological data, particularly DNA, RNA, and protein sequences. The field of bioinformatics experienced explosive growth starting in the mid-1990s, driven largely by the Human Genome Project and by rapid advances in DNA sequencing technology. Analyzing biological data to produce meaningful information involves writing and running software programs that use algorithms from graph theory, artificial intelligence, soft computing, data mining, image processing, and computer simulation. The algorithms in turn depend on theoretical foundations such as discrete mathematics, control theory, system theory, information theory, and statistics.
represents the turnover rate, or the number of reactions catalyzed by an enzyme over the enzyme amount. k c a t {\displaystyle k_{cat}} over k m {\displaystyle k_{m}} is known as the specificity constant, which gives a measure of the affinity of a substrate to some particular enzyme. Also known as the efficiency of an enzyme, this relationship reveals an enzyme's preference for a particular substrate. The higher the specificity constant of an enzyme corresponds to a high preference for that substrate.
P-glycoprotein (3.A.1.201.1) is a well-studied protein associated with multi-drug resistance. It belongs to the human ABCB (MDR/TAP) family and is also known as ABCB1 or MDR1 Pgp. MDR1 consists of a functional monomer with two transmembrane domains (TMD) and two nucleotide-binding domains (NBD). This protein can transport mainly cationic or electrically neutral substrates as well as a broad spectrum of amphiphilic substrates. The structure of the full-size ABCB1 monomer was obtained in the presence and absence of nucleotide using electron cryo crystallography. Without the nucleotide, the TMDs are approximately parallel and form a barrel surrounding a central pore, with the opening facing towards the extracellular side of the membrane and closed at the intracellular face. In the presence of the nonhydrolyzable ATP analog, AMP-PNP, the TMDs have a substantial reorganization with three clearly segregated domains. A central pore, which is enclosed between the TMDs, is slightly open towards the intracellular face with a gap between two domains allowing access of substrate from the lipid phase. Substantial repacking and possible rotation of the TM helices upon nucleotide binding suggests a helix rotation model for the transport mechanism.
Sources: en.wikipedia.org
Purity is commonly assessed by HPLC, which separates creatine from related compounds such as creatinine. Water content is measured separately by Karl Fischer titration. Together these results help calculate the actual creatine content in a sample.
Creatine monohydrate contains water as part of its crystal structure, so some water is expected. Excess moisture can promote clumping, hydrolysis, or microbial growth. Karl Fischer titration measures total water and helps distinguish expected hydration from residual moisture.
Dicyandiamide, creatinine, and related nitrogenous compounds are common markers. Their levels are controlled by manufacturing processes and product specifications. Heavy metals and microbial limits may also be tested depending on the intended grade.
Creatine monohydrate is the hydrated solid form of creatine, a nitrogen-containing compound involved in cellular energy metabolism. It consists of one creatine molecule associated with one water molecule in a crystal lattice.